PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00661.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 340aa    MW: 38371.3 Da    PI: 4.5644
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00661.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding544e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT eEd++l+ +++++G g W+ I+++ g++R++k+c++rw +yl
  Rsa1.0_00661.1_g00001.1 14 KGAWTIEEDKKLISYIQEHGEGGWRDIPQKAGLKRCGKSCRLRWANYL 61
                             79********************************************97 PP

2Myb_DNA-binding46.67.8e-1567112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg ++ eE+++++ +++  G++ W+ Iar+++ +Rt++++k++w+++l
  Rsa1.0_00661.1_g00001.1  67 RGEFSYEEEQIIIMLHASRGNK-WSVIARHLP-KRTDNEIKNYWNTHL 112
                              899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-24664IPR009057Homeodomain-like
PROSITE profilePS5129423.742965IPR017930Myb domain
SuperFamilySSF466893.44E-2911108IPR009057Homeodomain-like
SMARTSM007172.9E-121363IPR001005SANT/Myb domain
PfamPF002494.1E-161461IPR001005SANT/Myb domain
CDDcd001678.78E-101661No hitNo description
Gene3DG3DSA:1.10.10.607.7E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129418.87366116IPR017930Myb domain
SMARTSM007172.5E-1366114IPR001005SANT/Myb domain
PfamPF002491.9E-1367112IPR001005SANT/Myb domain
CDDcd001675.47E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009682Biological Processinduced systemic resistance
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0050832Biological Processdefense response to fungus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MSRKACCVGE GLKKGAWTIE EDKKLISYIQ EHGEGGWRDI PQKAGLKRCG KSCRLRWANY  60
LKPDIKRGEF SYEEEQIIIM LHASRGNKWS VIARHLPKRT DNEIKNYWNT HLKKRLLDQG  120
IDPLTHKPLA SNPEPATPKT SDFQDDSNPS NLDEQSHSGS MSPKSLHLSS GSCNSEETPR  180
NYGYLKSKKS SATSELLNKV ATRAASMGNI ISASMEGTLI PSTTLSQPCL NDGFSETSQF  240
QMDELDPFSN SSEYIDHMKE DICMNFDLNN SDYDFSQFLE QFNNDAAEEA DDIIGYDQDL  300
LLSDDVSSTS VDEDSMMRNL TDWSNYLLDD SDFSHDTNQD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-25121162105C-Myb DNA-Binding Domain
1msf_C3e-25121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX3160320.0JX316032.1 Brassica juncea R2R3 DNA binding transcription factor MYB29-2 (MYB29-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009131005.10.0PREDICTED: transcription factor MYB29-like
RefseqXP_013725873.10.0PREDICTED: transcription factor MYB29-like
SwissprotQ9FLR11e-166MYB29_ARATH; Transcription factor MYB29
TrEMBLS4TB340.0S4TB34_BRAJU; R2R3 DNA binding transcription factor MYB29-2
STRINGBra005949.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37871860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07690.11e-155myb domain protein 29